DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and CG14877

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:202 Identity:41/202 - (20%)
Similarity:72/202 - (35%) Gaps:51/202 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILVLLLLG-----------CQRSNPLAAGATVSSMRRLTDTIN-IGFLAEYSQMRVTLGGLPLAI 66
            :|||||:|           | |..|......:........||. :..|.:.:..:.:|       
  Fly     2 LLVLLLVGLVFGPKDCVATC-REEPARDCEAICDANGRNCTIRALVLLPDDNMYQASL------- 58

  Fly    67 EDVNKNPNLLPGKKLAFK--------PVDIGHKMSAYRVK------PLRAMTQMREAGVTAFIGP 117
                  |.:||..|:|.:        |..|..:..|:..|      .::||..:.:.......||
  Fly    59 ------PRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGP 117

  Fly   118 --DESCTTEALLASAWN---TPMLSFKCSDPIVSNKST-----FHTFART-LAPASKVSKSVISL 171
              |.|....:.:...:|   ||::|...|......|.|     |:...|| :.....:|:..|::
  Fly   118 VCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINV 182

  Fly   172 LNAFHWN 178
            :...:|:
  Fly   183 MKRHNWS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365 31/161 (19%)
ANF_receptor 59..427 CDD:279440 29/145 (20%)
PHA02988 534..826 CDD:165291
PK_GC-A_B 550..832 CDD:270944
HNOBA <847..886 CDD:285003
CYCc 865..1057 CDD:214485
Guanylate_cyc 892..1076 CDD:278633
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 30/157 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.