DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and Ac76E

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster


Alignment Length:280 Identity:79/280 - (28%)
Similarity:135/280 - (48%) Gaps:54/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   841 MLSIMEKYAYNLEGLVQERTNLLYEEKKKTD------------MLLYQMLPRPVAE---LLKRGD 890
            ::.|:..:..:.:|....||:.|::.|.|.:            :||..:||..||.   .|:|..
  Fly  1035 LVIILVLHTLDRQGEYVARTDFLWKAKLKVEQEEVETMRGINKILLENILPAHVATHFLHLERST 1099

  Fly   891 PVEAECFDCVTILFSDIVGFTELC----TTSTPFEVVEMLNDWYTCCDSIISNYD---------- 941
            .:..|.:.||.::|:.|..:.|..    ......|.:.:||:       ||.::|          
  Fly  1100 ELYHESYSCVAVMFASIPNYKEFYDETDVNKQGLECLRLLNE-------IICDFDKLLLKPKFSG 1157

  Fly   942 VYKVETIGDAYMVVSGL--PLQNG--SRHAGE-----------IASLALHLLETVGNLKIRHKPT 991
            :.|::||...||..|||  ..::|  ||...:           :...|:.|:..:.:  |..:..
  Fly  1158 IEKIKTIASTYMCASGLRPGKEDGATSRSFADEKRTEEHNVVILVEFAIALMSILDS--INRESF 1220

  Fly   992 ETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSMRIHISEATYQLLQVIGSYV 1056
            :..:||||::.||..|||:|.:.|:|.::.:|||.||||:|.|...|:..:|.|.::|...| |.
  Fly  1221 QRFRLRIGLNHGPVIAGVIGAQKPQYDIWSNTVNVASRMDSCGVMGRLQTTENTAKILMTAG-YE 1284

  Fly  1057 CIERGLTSIKGKGDMRTYWL 1076
            |..||||.:||||::.||::
  Fly  1285 CECRGLTYVKGKGNLVTYFV 1304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291
PK_GC-A_B 550..832 CDD:270944
HNOBA <847..886 CDD:285003 12/53 (23%)
CYCc 865..1057 CDD:214485 63/235 (27%)
Guanylate_cyc 892..1076 CDD:278633 64/212 (30%)
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485 60/213 (28%)
Guanylate_cyc 1101..1305 CDD:278633 64/214 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453904
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.