DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and Ac13E

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster


Alignment Length:315 Identity:87/315 - (27%)
Similarity:146/315 - (46%) Gaps:54/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 DPEVRPDIRLVRMHLKELQAGLKPNIFD--NMLSIMEKYAYNLEGLVQERTNLLYEEKKKTDMLL 874
            ||..|..|..:..||.....|:...|.:  .|.....|...||  ||:.:..:   ||:..:.::
  Fly   252 DPSNRILILRIMAHLSVHLVGVHVLIMNLVRMRGTFMKVGQNL--LVRRQLEM---EKQLKEKMI 311

  Fly   875 YQMLPRPVAE-LLKRGD-----------------------------PVEAECFDCVTILFSDIVG 909
            :.::|..||: ||..|.                             |......:.|:|||:||||
  Fly   312 HSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVG 376

  Fly   910 FTELCTTSTPFEVVEMLNDWYTCCDSIISNYDVYKVETIGDAYMVVSGLPLQNGSRHAGEIASLA 974
            ||.:.:|.|..::||:|||.:...|.:.|.....|:.|:||.|..|||.| :..:.||.....:.
  Fly   377 FTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCP-EPRADHAICCVEMG 440

  Fly   975 LHLLETVGNLKI-RHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSMR 1038
            |.:::.:..... ||   |.|::|:|||:|....|:||.:..::.::.:.|:.|::|||:|...:
  Fly   441 LGMIDAMRCFDAQRH---EGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQ 502

  Fly  1039 IHISEATYQLLQVIGSYVCIERGLTSIKGKGDMRTYWLTKRQQP-----ELTPDL 1088
            :|||:.|...|   |....:|.| ..:.|.   |||::..|::.     .|:|.:
  Fly   503 VHISQETSSFL---GDAYYLEEG-EEVFGH---RTYFVVGRRRDFTRTNSLSPSM 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291 4/13 (31%)
PK_GC-A_B 550..832 CDD:270944 6/19 (32%)
HNOBA <847..886 CDD:285003 10/39 (26%)
CYCc 865..1057 CDD:214485 64/222 (29%)
Guanylate_cyc 892..1076 CDD:278633 61/184 (33%)
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 64/225 (28%)
Guanylate_cyc 361..535 CDD:278633 61/184 (33%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.