DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and Adcy8

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_058838.1 Gene:Adcy8 / 29241 RGDID:2036 Length:1248 Species:Rattus norvegicus


Alignment Length:333 Identity:97/333 - (29%)
Similarity:153/333 - (45%) Gaps:61/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   847 KYAYNLEGL----VQERTNLLYEEKKKTDMLLYQMLPRPVAE--LLKRGDPVE--AECFDCVTIL 903
            :|...|:.|    .:|..|.:.:.::..:.:|..:||..||.  |.|..|..|  ::.:|.|.::
  Rat   917 EYTARLDFLWRVQAKEEINEMKDLREHNENMLRNILPGHVARHFLEKDRDNEELYSQSYDAVGVM 981

  Fly   904 FSDIVGFTELCTTSTPFEVVEMLNDWYTC---CDSIISNY----------DVYKVETIGDAYMVV 955
            |:.|.||.:.      :...||.|....|   .:.||:::          |:.|::|||..||.|
  Rat   982 FASIPGFADF------YSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAV 1040

  Fly   956 SGL-----PLQNGSRHAGEIASLALHLLETVGNLKIRHKPTETVQLRIGVHSGPCAAGVVGQKMP 1015
            |||     ..::...|...:|..:|.|.|::..:. :|. ....:||||:..|...|||:|.|.|
  Rat  1041 SGLSPEKQQCEDKWGHLCALADFSLALTESIQEIN-KHS-FNNFELRIGISHGSVVAGVIGAKKP 1103

  Fly  1016 RYCLFGDTVNTASRMESTGDSMRIHISEATYQLLQVIGSYVCIERGLTSIKG----KGDMRTYWL 1076
            :|.::|.|||.||||:|||.|.||.:.|.||.:|:..| :....||...:||    :|.::||:|
  Rat  1104 QYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQG-FAFDYRGEIYVKGISEQEGKIKTYFL 1167

  Fly  1077 TKRQQPE---LTPDLISTVDTLDTYCSGPRESMEVSVHQYCSPASNNYRLGSCNCDTKCLYSRRS 1138
            ..|.||.   |.|..:....:|.....|..:|:            |..|       .|.|.:..|
  Rat  1168 LGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSL------------NRQR-------QKQLLNENS 1213

  Fly  1139 DDNVTNSH 1146
            :..:..||
  Rat  1214 NSGIIKSH 1221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291
PK_GC-A_B 550..832 CDD:270944
HNOBA <847..886 CDD:285003 10/44 (23%)
CYCc 865..1057 CDD:214485 69/213 (32%)
Guanylate_cyc 892..1076 CDD:278633 68/207 (33%)
Adcy8NP_058838.1 Involved in ORAI1, STIM1, PPP2CA and PPP2R1A interaction. /evidence=ECO:0000269|PubMed:16258073, ECO:0000269|PubMed:22494970, ECO:0000269|PubMed:22976297 1..179
Involved in AKAP5 and PRKAR2A interaction. /evidence=ECO:0000269|PubMed:22976297 1..106
Essential for CALM1 interaction. /evidence=ECO:0000269|PubMed:16258073 38..40
Essential for CALM1 interaction. /evidence=ECO:0000269|PubMed:16258073 49..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..117
AC_N <158..397 CDD:292831
CYCc 363..561 CDD:214485
Guanylate_cyc 402..586 CDD:278633
DUF1053 614..708 CDD:283888
CYCc 941..1145 CDD:214485 69/212 (33%)
Guanylate_cyc 970..1169 CDD:278633 68/207 (33%)
Involved in CALM1 interaction. /evidence=ECO:0000269|PubMed:16258073 1106..1248 42/136 (31%)
Required for both calcium stimulation and maintenance of autoinhibition. /evidence=ECO:0000269|PubMed:19305019 1197..1212 5/33 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1220..1248 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.