DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and Adcy10

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_766617.2 Gene:Adcy10 / 271639 MGIID:2660854 Length:1614 Species:Mus musculus


Alignment Length:543 Identity:101/543 - (18%)
Similarity:189/543 - (34%) Gaps:206/543 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 GLLWKVDMKDVTVI----NLGEYNNPTNKNIFQICRQSILVVGEPNKRSFTNIALFRGNI----- 583
            |:|..||:...|.:    :...|.:...:.:.:|....|..:.|       .:.:|.|:|     
Mouse    41 GVLMFVDISGFTAMTEKFSTAMYMDRGAEQLVEILNYYISAIVE-------KVLIFGGDILKFAG 98

  Fly   584 ---VAMKKIHKKSVD--ITRSIRKELKL--MREVRHE----NIINFIGASTDHGSVIIFTTYCAR 637
               :|:.|:.:|.:.  ||..|:..|::  :.|.:..    :|...||.:..|.::::|      
Mouse    99 DALLALWKVERKQLKNIITVVIKCSLEIHGLFEAKEAEEGLDIRVKIGLAAGHITMLVF------ 157

  Fly   638 GSLEDVLANEDLHLDHMFISSLVSDI--LKGMIYLHDSEIISHGNLRSSNCLIDSRWVCQISDFG 700
                    .::.....:.|...|.|:  .:.|..::|.       :.|.||     |  |:.|  
Mouse   158 --------GDETRNYFLVIGQAVDDVRLAQNMAQMNDV-------ILSPNC-----W--QLCD-- 198

  Fly   701 LHELKAGQEEPNKSELELKRALCMAPELLRDAYRPGRGSQKGDVYSFGILLYEMIGRKGPWGDTA 765
                        :|.:|::|    .|:            |:....||         .|.|   ..
Mouse   199 ------------RSMIEIER----IPD------------QRAVKVSF---------LKPP---PT 223

  Fly   766 YSKEEIIQFVKCPEMLQHGVFRPALTHTHLDIPDYIR-KCLCQCWDEDPEVRPDIR--LVRMHLK 827
            ::.:|.  |.||...:.   :.|:..|     .:::| .|:.   :.|||:...::  ::.:.||
Mouse   224 FNFDEF--FTKCMGFMD---YYPSGDH-----KNFLRLACML---ESDPELELSLQKYVMEIILK 275

  Fly   828 ELQAGLKPNIFDNMLSIMEKYAYNLEGLVQERTNLLYEEKKKTDMLLYQMLPRPVAELLKRGDPV 892
            ::.        |..|   ..|...|..:.....||:::|:.|.:::               |..:
Mouse   276 QID--------DKQL---RGYLSELRPVTIVFVNLMFKEQDKVEVI---------------GSAI 314

  Fly   893 EAECFDCVTIL------FSDIVGFTELCTTSTPFEVVEMLNDWYTCCDSIISNYDVYKVETIGDA 951
            :|.|....::|      .:.:..|.:.|                                    :
Mouse   315 QAACVHITSVLKVFRGQINKVFMFDKGC------------------------------------S 343

  Fly   952 YMVVSGLPLQNGSRHAGEIASLALHLLETVGNL--------KIRHKPTETVQLRIGVHSGPCAAG 1008
            ::.|.|.|   |.:...||.    |.||:..::        |||     ||.  |||.||....|
Mouse   344 FLCVFGFP---GEKAPDEIT----HALESAVDIFDFCSQVHKIR-----TVS--IGVASGIVFCG 394

  Fly  1009 VVGQKM-PRYCLFGDTVNTASRM 1030
            :||..: ..|.:.|..||.|:||
Mouse   395 IVGHTVRHEYTVIGQKVNIAARM 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291 53/316 (17%)
PK_GC-A_B 550..832 CDD:270944 52/302 (17%)
HNOBA <847..886 CDD:285003 6/38 (16%)
CYCc 865..1057 CDD:214485 37/181 (20%)
Guanylate_cyc 892..1076 CDD:278633 34/154 (22%)
Adcy10NP_766617.2 CHD 40..214 CDD:143636 41/237 (17%)
CHD 292..461 CDD:143636 39/191 (20%)
COG3899 485..>959 CDD:226415
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.