DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and Adcy5

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001012783.3 Gene:Adcy5 / 224129 MGIID:99673 Length:1262 Species:Mus musculus


Alignment Length:235 Identity:80/235 - (34%)
Similarity:124/235 - (52%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   865 EEKKKTD-------MLLYQMLPRPVAELL----KRGDPVEAECFDCVTILFSDIVGFT----ELC 914
            |||::.:       .||:.:||:.||...    :|.|.:..:..:||.::|:.|..|:    ||.
Mouse  1025 EEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELE 1089

  Fly   915 TTSTPFEVVEMLNDWYTCCDSIISN---YDVYKVETIGDAYMVVSGLPLQN----GSRHAGEIAS 972
            ..:...|.:.:||:.....|.|||.   ..:.|::|||..||..|||....    |..|...||.
Mouse  1090 ANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKAGKTHIKAIAD 1154

  Fly   973 LALHLLETVGNLK-IRHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDS 1036
            .|:.|::   .:| |........|::||::.||..|||:|.:.|:|.::|:|||.||||:|||..
Mouse  1155 FAMKLMD---QMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVP 1216

  Fly  1037 MRIHISEATYQLLQVIGSYVCIERGLTSIKGKGDMRTYWL 1076
            .||.::...||:| ...:|....||:..:||||:|.||:|
Mouse  1217 DRIQVTTDMYQVL-AANTYQLECRGVVKVKGKGEMMTYFL 1255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291
PK_GC-A_B 550..832 CDD:270944
HNOBA <847..886 CDD:285003 9/27 (33%)
CYCc 865..1057 CDD:214485 70/214 (33%)
Guanylate_cyc 892..1076 CDD:278633 68/195 (35%)
Adcy5NP_001012783.3 AC_N 1..459 CDD:292831
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..194
CYCc 425..620 CDD:214485
Guanylate_cyc 461..622 CDD:278633
DUF1053 669..761 CDD:283888
CYCc 1037..1238 CDD:214485 67/204 (33%)
Guanylate_cyc 1063..1257 CDD:278633 69/197 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.