DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and ADCY9

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:XP_005255136.1 Gene:ADCY9 / 115 HGNCID:240 Length:1372 Species:Homo sapiens


Alignment Length:268 Identity:85/268 - (31%)
Similarity:132/268 - (49%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 YAYNLEGLVQ---ERTNLLYEEKKKTDMLLYQMLPRPVAELLKRGDPVEAECFDCVTILFSDIVG 909
            |..:..|.|:   .||. :...:.:.|.||..::|..|||.||... ..::..|...::|:.||.
Human  1023 YRLHYHGDVEADLHRTK-IQSMRDQADWLLRNIIPYHVAEQLKVSQ-TYSKNHDSGGVIFASIVN 1085

  Fly   910 FTELCTTSTP--FEVVEMLNDWYTCCDSIISNYD---VYKVETIGDAYMVVSGL---PLQNGS-- 964
            |:|....:..  .|...:||:.....|.::|..|   :.|::|||..||..|||   ..|:||  
Human  1086 FSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHP 1150

  Fly   965 -RHAGEIASLALHLLETVGNLKIRHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTAS 1028
             .|...:...|..::..|.:.. .:......:||:|.:.||..|||:|.....|.::|||||.||
Human  1151 QEHLQILFEFAKEMMRVVDDFN-NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIAS 1214

  Fly  1029 RMESTGDSMRIHISEATYQLLQVIGSYVCIERGLTSIKGKGDMRTYWLTK--------RQQPELT 1085
            ||::||...||.:||.:|::|..:| |....||..::||||.|:||...|        :.|..::
Human  1215 RMDTTGVECRIQVSEESYRVLSKMG-YDFDYRGTVNVKGKGQMKTYLYPKCTDHRVIPQHQLSIS 1278

  Fly  1086 PDLISTVD 1093
            ||:...||
Human  1279 PDIRVQVD 1286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291
PK_GC-A_B 550..832 CDD:270944
HNOBA <847..886 CDD:285003 12/40 (30%)
CYCc 865..1057 CDD:214485 65/202 (32%)
Guanylate_cyc 892..1076 CDD:278633 65/194 (34%)
ADCY9XP_005255136.1 DUF2339 <118..>301 CDD:287113
CYCc 326..544 CDD:214485
Guanylate_cyc 385..573 CDD:278633
CYCc 1043..1243 CDD:214485 65/202 (32%)
Guanylate_cyc 1069..1260 CDD:278633 64/192 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.