DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc32E and gucy1b1

DIOPT Version :9

Sequence 1:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:655 Identity:171/655 - (26%)
Similarity:263/655 - (40%) Gaps:192/655 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   573 FTNIALFRGNIVAMKKIHKKSVDITRSIRKELKLMRE----VR----HENIINFIGAST-----D 624
            |.|.||      .:..|.....::...|:||.:|..|    ||    .....:.:.|:|     :
 Frog     4 FVNHAL------ELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLN 62

  Fly   625 HGSVI-----IFTTYCARGSLEDVLANEDLHLDHMFISSLVSDILKGMIYLHDSEIISHGNLR-- 682
            .|.::     :|..:|.....:.:|         ..:.|.|.:.|:.:..|||.....:..:|  
 Frog    63 AGDILQMFGNMFFVFCQESGYDTIL---------RVLGSNVREFLQNLDALHDHLGTIYPGMRAP 118

  Fly   683 SSNCLIDSRWVCQISDF-----GLHELKAG-----QEEPNKSELELK-----RALCMAPELL--- 729
            |..|....:....|..:     ||.::..|     .::.:.:|:::|     ...|...:.|   
 Frog   119 SFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEE 183

  Fly   730 -----RDAYR-----PGRGSQKGDV--YSF-------------------GILLYEMIGRKGPWGD 763
                 .|.|.     ...|:|:..:  |:|                   |..:|.::.:..|...
 Frog   184 KDTREEDFYEDQDRFEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNC 248

  Fly   764 TAYSKEEIIQFVKCP--EMLQHGVFRPALTHTH-----------LDIPDYIRKCLCQCWDEDPEV 815
            ...|...:::    |  ::..||:    |:|.:           ||:.        :...||...
 Frog   249 NLLSVFSLVR----PHIDISFHGI----LSHINTVFVLRSKEGLLDVE--------KSESEDELT 297

  Fly   816 RPDIRLVRM-----HLKELQAGLKPNIFDNMLSIMEKYAYNLEGL-------------------- 855
            ..:|..:|:     :|.|.         ||:|.:......||:.|                    
 Frog   298 GTEISCLRLKGQMIYLPEA---------DNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLV 353

  Fly   856 ----------------------VQERTNLLYEEKKKTDMLLYQMLPRPVAELLKRGDPVEAECFD 898
                                  :|.....|.:||||||.|||.:||..||..|:...||.|:.:|
 Frog   354 LLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYD 418

  Fly   899 CVTILFSDIVGFTELCTTSTPFE----VVEMLNDWYTCCDSII---SNYDVYKVETIGDAYMVVS 956
            .||||||.||||...|:.....|    :|.:|||.||..|.:.   :|..||||||:||.||.||
 Frog   419 NVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVS 483

  Fly   957 GLPLQNGSRHAGEIASLALHLLETVGNLKIRHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFG 1021
            |:| :....||..|..|||.::|..|.:::   ..|:||:.||:|:|....||:||:||||||||
 Frog   484 GIP-EPCVHHARSICHLALDMMEIAGQVQV---DGESVQITIGIHTGEVVTGVIGQRMPRYCLFG 544

  Fly  1022 DTVNTASRMESTGDSMRIHISEATYQLL--------QVIGSYVCIERGLTSIKGKGDMRTYWLTK 1078
            :|||..||.|:||:..:|::||.||:.|        |....|    ||..|:|||.|....|...
 Frog   545 NTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQY----RGPVSMKGKTDPMQVWFLS 605

  Fly  1079 RQQPE 1083
            |:..|
 Frog   606 RKAAE 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291 56/339 (17%)
PK_GC-A_B 550..832 CDD:270944 58/345 (17%)
HNOBA <847..886 CDD:285003 18/80 (23%)
CYCc 865..1057 CDD:214485 95/206 (46%)
Guanylate_cyc 892..1076 CDD:278633 87/198 (44%)
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902 32/176 (18%)
HNOBA 207..406 CDD:369471 40/223 (18%)
Guanylate_cyc 412..605 CDD:306677 88/200 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.