DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4751 and AMSH1

DIOPT Version :10

Sequence 1:NP_609495.1 Gene:CG4751 / 34551 FlyBaseID:FBgn0032348 Length:1412 Species:Drosophila melanogaster
Sequence 2:NP_564533.1 Gene:AMSH1 / 841301 AraportID:AT1G48790 Length:507 Species:Arabidopsis thaliana


Alignment Length:151 Identity:35/151 - (23%)
Similarity:61/151 - (40%) Gaps:22/151 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 VHDANMLIE-SVPFTSVGKLQPFLITVNSSALLLADFHCHLTVR------EVCGYLGGTWDMNTH 318
            |.:...:|| |:|..|:....|..:.:.:|   :.|....|...      |.||.|.|:  :...
plant   309 VREPECMIENSLPDESLRSESPLELHIATS---MMDTFMRLAKSNTKKNLETCGILAGS--LKNR 368

  Fly   319 TLSITK-TYPCRSTRFDRQRAGEVERDIQKMMIQDQLLLVGWYHSHPKFQAEPTLRDCDAQLDYQ 382
            ...||. ..|.:.:..|..:|.. |.:|.::..:..|..:||.|:||......:..|......||
plant   369 KFYITALIIPKQESTSDSCQATN-EEEIFEVQDKQSLFPLGWIHTHPTQSCFMSSIDVHTHYSYQ 432

  Fly   383 IKMRGASDLTYTPCVSLIISP 403
            |.:..|        |:::::|
plant   433 IMLPEA--------VAIVMAP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4751NP_609495.1 RAMA 124..220 CDD:465856
MPN_2A_DUB 278..463 CDD:163698 29/133 (22%)
PHA03247 <616..741 CDD:223021
AMSH1NP_564533.1 USP8_dimer 1..104 CDD:462647
MPN_AMSH_like 333..507 CDD:163697 28/127 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.