DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4751 and COPS6

DIOPT Version :10

Sequence 1:NP_609495.1 Gene:CG4751 / 34551 FlyBaseID:FBgn0032348 Length:1412 Species:Drosophila melanogaster
Sequence 2:NP_006824.2 Gene:COPS6 / 10980 HGNCID:21749 Length:327 Species:Homo sapiens


Alignment Length:98 Identity:21/98 - (21%)
Similarity:32/98 - (32%) Gaps:34/98 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 NRNVVHDANMLIESVPFTSVGKLQPFLITVNSSALLLADFHCHLTVREVCGYLGGTWDMNTHTLS 321
            |..::.:|..|...:|..|..|.:             .||:.......:..|||          :
Human   253 NHEILREAYALCHCLPVLSTDKFK-------------TDFYDQCNDVGLMAYLG----------T 294

  Fly   322 ITKTYPCRSTR---------FDRQRAGEVERDI 345
            ||||  |.:..         :|||..|...|.:
Human   295 ITKT--CNTMNQFVNKFNVLYDRQGIGRRMRGL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4751NP_609495.1 RAMA 124..220 CDD:465856
MPN_2A_DUB 278..463 CDD:163698 16/77 (21%)
PHA03247 <616..741 CDD:223021
COPS6NP_006824.2 MPN_CSN6 39..321 CDD:163694 20/92 (22%)
Interaction with Vpr 211..327 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.