DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and RFC3

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_014109.1 Gene:RFC3 / 855426 SGDID:S000005234 Length:340 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:86/283 - (30%)
Similarity:127/283 - (44%) Gaps:50/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||..|.::....:....:|....:...|||:||||.|.||.:.|:.|.||:||...    
Yeast    15 WVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREIYGKNY---- 75

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDR--TVVIDLIKQVAQTHQIEISGQREFKV 131
                                ||..||:|.||    ||  .||.:.||..|.|.||...|   ||:
Yeast    76 --------------------SNMVLELNASD----DRGIDVVRNQIKDFASTRQIFSKG---FKL 113

  Fly   132 IVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSIL 196
            |::.|.|.:|..||:||||.:|:|....|..:..|...::.||:.|||...|.....:..|...:
Yeast   114 IILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRI 178

  Fly   197 QNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQEIPDLDWQVFLRETASQ 261
            .|....|.|.|.....|.:::.|..::||.|.:|::.|       |..:.||.|      |.:..
Yeast   179 ANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCK-------ATLDNPDED------EISDD 230

  Fly   262 IISE----QTPAKLEKIRERLYE 280
            :|.|    ..|:.|:.:.:.:.|
Yeast   231 VIYECCGAPRPSDLKAVLKSILE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 86/283 (30%)
RFC3NP_014109.1 rfc 11..324 CDD:234763 86/283 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.