DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and RFC4

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_014547.1 Gene:RFC4 / 854059 SGDID:S000005454 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:240 Identity:65/240 - (27%)
Similarity:117/240 - (48%) Gaps:50/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREM----YGSGV 64
            ||:||||:.||.:..:|:..:.|:.:.|..:.||::..|..|.||.|.:.||..|:    |..||
Yeast    11 WVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGV 75

  Fly    65 ERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQIEISGQREF 129
                                        ||:|.||    ||.  ||:::     :||:...|::.
Yeast    76 ----------------------------LELNASD----DRG--IDVVR-----NQIKHFAQKKL 101

  Fly   130 -------KVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAP 187
                   |::::.|.|.:|..||.|||||||.|..:.|...:.|.:::||..::|||..:|.:..
Yeast   102 HLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSRCAILRYSKL 166

  Fly   188 NETEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEA 232
            ::.:::..|....|.|.:....:..:.::..:|.::|:|:..|::
Yeast   167 SDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 65/240 (27%)
RFC4NP_014547.1 PLN03025 9..323 CDD:178596 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.