DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and RFC2

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_012602.3 Gene:RFC2 / 853531 SGDID:S000003829 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:365 Identity:92/365 - (25%)
Similarity:162/365 - (44%) Gaps:56/365 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||:.|.::.........|:...|.::.||::||||.|.||.:.|:.|.:|:||..:.:.|
Yeast    27 WVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPHMLFYGPPGTGKTSTILALTKELYGPDLMKSR 91

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDR--TVVIDLIKQVAQ-------THQIEIS 124
            .                       ||:|.||    :|  ::|.:.:|..|:       .|.:|..
Yeast    92 I-----------------------LELNASD----ERGISIVREKVKNFARLTVSKPSKHDLENY 129

  Fly   125 GQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNE 189
            ....:|:|::.|.|.:|.|||.|||||||.|....|..:..|..:|||..:.|||...|..|.:.
Yeast   130 PCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPLASRCSKFRFKALDA 194

  Fly   190 TEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQEIPDLDWQ-- 252
            :..:..|:...::|.:.....:.:|::|.|..:|||.:.:|::|..........:.|.....:  
Yeast   195 SNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASKGAQYLGDGKNITSTQVEEL 259

  Fly   253 --VFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKT---- 311
              |...:...:|:.:......::|::.:...:..|.....:...|.|..:.|.:.....|.    
Yeast   260 AGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASVVNQLHEYYITNDNFDTNFKNQISW 324

  Fly   312 LEFATEYEHRMQSGA-KHIFHLEAFVAQFMNIYKKFLSEL 350
            |.|.|  :.|:.:|. :||        |.:|:..| :|:|
Yeast   325 LLFTT--DSRLNNGTNEHI--------QLLNLLVK-ISQL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 89/358 (25%)
RFC2NP_012602.3 rfc 23..353 CDD:234763 91/363 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.