DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and RFC2

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_176504.1 Gene:RFC2 / 842620 AraportID:AT1G63160 Length:333 Species:Arabidopsis thaliana


Alignment Length:336 Identity:91/336 - (27%)
Similarity:157/336 - (46%) Gaps:58/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||.::..:..::|....|:.:.:..:.|:|:..||.|.||.|.|:.|..|:.|       
plant    17 WVEKYRPSKVVDIVGNEDAVSRLQVIARDGNMPNLILSGPPGTGKTTSILALAHELLG------- 74

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDR--TVVIDLIKQVAQTHQIEISGQREFKV 131
                     :|.|..|        ||:|.||    ||  .||.:.||..||.......|:.  ||
plant    75 ---------TNYKEAV--------LELNASD----DRGIDVVRNKIKMFAQKKVTLPPGRH--KV 116

  Fly   132 IVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSIL 196
            :::.|.|.:|..||.|||||:|.|..:.|..::.|::::||..|:|||..:|.:..::.:|:..|
plant   117 VILDEADSMTSGAQQALRRTIEIYSNSTRFALACNTSAKIIEPIQSRCALVRFSRLSDQQILGRL 181

  Fly   197 QNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFT----ANQE----IPDLDWQV 253
            ......|.:....|..:.::..::.::|:||..|:|.      |:    .|||    :.|....:
plant   182 LVVVAAEKVPYVPEGLEAIIFTADGDMRQALNNLQAT------FSGFSFVNQENVFKVCDQPHPL 240

  Fly   254 FLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKTLEFATEY 318
            .::.....::..:.....:.::: ||:|   |..|..|...|. :::.|.||:...| |||..| 
plant   241 HVKNIVRNVLESKFDIACDGLKQ-LYDL---GYSPTDIITTLF-RIIKNYDMAEYLK-LEFMKE- 298

  Fly   319 EHRMQSGAKHI 329
                 :|..|:
plant   299 -----TGFAHM 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 91/336 (27%)
RFC2NP_176504.1 PLN03025 16..333 CDD:178596 91/336 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.