DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and EMB1968

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001185061.1 Gene:EMB1968 / 838771 AraportID:AT1G21690 Length:341 Species:Arabidopsis thaliana


Alignment Length:364 Identity:96/364 - (26%)
Similarity:161/364 - (44%) Gaps:58/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||:::..:...::....|.|..:.:|.||::||||.|.||.|..:.:..:::|       
plant    11 WVEKYRPKQVKDVAHQEEVVRVLTNTLQTADCPHMLFYGPPGTGKTTTALAIAHQLFG------- 68

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDR--TVVIDLIKQ-----VAQTHQIEISGQ 126
                    |...|..|        ||:|.||    ||  .||...||.     |...|:......
plant    69 --------PELYKSRV--------LELNASD----DRGINVVRTKIKDFAAVAVGSNHRQSGYPC 113

  Fly   127 REFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETE 191
            ..||:|::.|.|.:|:|||:|||||||.|....|.....|..||||..:.|||...|....:|..
plant   114 PSFKIIILDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEV 178

  Fly   192 IVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQEIPDLDWQVFLR 256
            :.:.:.:.|..|||:|..|....:...|:.:||||:..|::|.........:.::.::...|.| 
plant   179 MSNRILHICNEEGLSLDGEALSTLSSISQGDLRRAITYLQSATRLFGSTITSTDLLNVSGVVPL- 242

  Fly   257 ETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSI----KAKTLEFATE 317
            |..:::.:.......:...:.:..::.:|.|.:.|...|.: :|...|..|    |||..:...|
plant   243 EVVNKLFTACKSGDFDIANKEVDNIVAEGYPASQIINQLFD-IVAEADSDITDMQKAKICKCLAE 306

  Fly   318 YEH----RMQSGAKHIFHLEAFVAQFMNIYKKFLSELDM 352
            .:.    .:::|::              :..:.|.|||:
plant   307 TDKYNLCPLRNGSR--------------LLMQILLELDL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 92/355 (26%)
EMB1968NP_001185061.1 PRK12402 11..308 CDD:237090 91/325 (28%)
AAA 26..166 CDD:99707 54/166 (33%)
AAA_assoc_2 189..>220 CDD:292811 11/30 (37%)
Rep_fac_C 256..>309 CDD:285713 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.