DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and RFC4

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_002907.1 Gene:RFC4 / 5984 HGNCID:9972 Length:363 Species:Homo sapiens


Alignment Length:355 Identity:99/355 - (27%)
Similarity:163/355 - (45%) Gaps:56/355 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||:.:.::.|.::....|:...:.:|.|:|:||||.|.||.:.|:...||::|..:.|||
Human    40 WVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLR 104

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSD-AGMYDRTVVIDLIKQVAQTHQIEISGQRE---- 128
            .                       ||:|.|| .|:   .||.:.:|..|   |:.:||.|.    
Human   105 V-----------------------LELNASDERGI---QVVREKVKNFA---QLTVSGSRSDGKP 140

  Fly   129 ---FKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNET 190
               ||::::.|.|.:|..||.||||||||...|.|..:..|..||||..:.|||...|....::.
Human   141 CPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDK 205

  Fly   191 EIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQEIPDLDWQVFL 255
            .....|.:..|:|.:.:..|....:|..||.:||:|:..|::|    ...|..:||.    :..:
Human   206 IQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSA----TRLTGGKEIT----EKVI 262

  Fly   256 RETASQIISEQ--------TPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKTL 312
            .:.|..|.:|:        .....:|:...:.:|:.:|.....:...|.:.:|.| ::|.|.|::
Human   263 TDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVEN-NLSDKQKSI 326

  Fly   313 --EFATEYEHRMQSGAKHIFHLEAFVAQFM 340
              |...|.:..:..||.....|.:..|..|
Human   327 ITEKLAEVDKCLADGADEHLQLISLCATVM 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 99/355 (28%)
RFC4NP_002907.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Rad17 39..353 CDD:330523 97/350 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.