DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and RFC2

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_852136.1 Gene:RFC2 / 5982 HGNCID:9970 Length:354 Species:Homo sapiens


Alignment Length:347 Identity:90/347 - (25%)
Similarity:162/347 - (46%) Gaps:53/347 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||.:|:::..::|....|....::.:.|:::..||.|.||.|.|:||.|.:.|..::   
Human    38 WVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALK--- 99

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPS-DAGMYDRTVVIDLIKQVAQTHQIEISGQREFKVI 132
                          :.|       ||:|.| |.|:   .||.:.||..||.......|:.  |:|
Human   100 --------------DAM-------LELNASNDRGI---DVVRNKIKMFAQQKVTLPKGRH--KII 138

  Fly   133 VISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSILQ 197
            ::.|.|.:|..||.|||||||.|..|.|..::.|::.:||..|:|||..:|.....:.:|::.|.
Human   139 ILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLM 203

  Fly   198 NTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTA----NQE----IPDLDWQVF 254
            |..::|.:....:..:.::..::.::|:||..|::.      |:.    |.|    :.|....:.
Human   204 NVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQST------FSGFGFINSENVFKVCDEPHPLL 262

  Fly   255 LRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKTLEFATE-- 317
            ::|.....::    |.:::..:.|..|...|..|..|. |.:.::.....|:...| |||..|  
Human   263 VKEMIQHCVN----ANIDEAYKILAHLWHLGYSPEDII-GNIFRVCKTFQMAEYLK-LEFIKEIG 321

  Fly   318 YEH-RMQSGAKHIFHLEAFVAQ 338
            |.| ::..|...:..:...:|:
Human   322 YTHMKIAEGVNSLLQMAGLLAR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 90/347 (26%)
RFC2NP_852136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
PLN03025 36..348 CDD:178596 90/347 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.