DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and rfc2

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001013344.2 Gene:rfc2 / 503748 ZFINID:ZDB-GENE-050306-29 Length:353 Species:Danio rerio


Alignment Length:340 Identity:90/340 - (26%)
Similarity:154/340 - (45%) Gaps:66/340 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||.:|:::..:::....|....::.:.|:::..||.|.||.|.|:||.|.:.|..::   
Zfish    37 WVEKYRPLKLNEIVGNEETVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPAMK--- 98

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPS-DAGMYDRTVVIDLIKQVAQTHQIEISGQREFKVI 132
                                 :..||:|.| |.|:   .||.:.||..||.......|:.  |:|
Zfish    99 ---------------------DAVLELNASNDRGI---DVVRNKIKMFAQQKVTLPKGRH--KII 137

  Fly   133 VISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSILQ 197
            ::.|.|.:|..||.|||||||.|..|.|..::.|::.:||..|:|||..:|.:...:.:|:..|.
Zfish   138 ILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYSKLRDEQIMMRLT 202

  Fly   198 NTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKV------AKAPFTANQEIPDLDWQVFLR 256
            ...::|.|.:..:..:.::..::.::|:||..|::...      ::..|....|...|..:..|.
Zfish   203 EVVEKENLHVTNDGLEAIIFTAQGDMRQALNNLQSTNSGFGYINSENVFKVCDEPHPLLVKSMLE 267

  Fly   257 ETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNN----CDMSIKAKTLEFATE 317
            ...:..|.|     ..||.|:|:.|   |..|        |.::.|    |      ||.:.| |
Zfish   268 HCVNANIDE-----AYKIIEQLWSL---GYSP--------EDIIGNIFRVC------KTFQMA-E 309

  Fly   318 Y---EHRMQSGAKHI 329
            |   |:..:.|..|:
Zfish   310 YLKLEYIKEIGYTHM 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 90/340 (26%)
rfc2NP_001013344.2 PLN03025 35..353 CDD:178596 90/340 (26%)
AAA 50..184 CDD:99707 48/162 (30%)
AAA_assoc_2 207..>235 CDD:292811 5/27 (19%)
Rep_fac_C 273..341 CDD:285713 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.