DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and Rad17

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650382.3 Gene:Rad17 / 41779 FlyBaseID:FBgn0025808 Length:535 Species:Drosophila melanogaster


Alignment Length:406 Identity:80/406 - (19%)
Similarity:140/406 - (34%) Gaps:124/406 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSD-----FPHLM--FYGPSGAGKKTRIMCLLREMYG 61
            |::.:.|.....|..|..:...||:..:..:     ||..|  ..||:||||.|.:..|.:| :|
  Fly    89 WMESFEPATSDDLAVHPKKVGELRDWLRHCEAVRKKFPAQMCLLTGPTGAGKTTTLRVLAKE-FG 152

  Fly    62 SGVERLRSETMTFTTPSNRKVEVM------TVSSNY---HLEVNPSDAGMYDRTVVIDLIKQVAQ 117
            ..::.       :..|.:  .||:      |..::|   |||...|           .|::  |.
  Fly   153 YQLQE-------WINPID--CEVVNTLGDQTTGASYVGSHLEAFKS-----------FLLR--AS 195

  Fly   118 THQIEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCR---IIISVNSTSRIIPAIRSRC 179
            .::..:..|.:..::|....:.|..|.:......:|:|.|..:   :.|..::.||.: .|..|.
  Fly   196 RYKSLLDSQNKRLLLVEDFPNVLLSDKEVNFEELLEEYTAYGKSPLVFIVADAKSRGL-NISYRL 259

  Fly   180 LGIRVAAPNETEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQ 244
            ...::.|.:..|.:|.  |.           :|..::.||.:..  ..:|.:.....|.|.||  
  Fly   260 FPDQLKAKHRIEHISF--NA-----------IASTIMQKSMKTF--CSVMQQNKATYKVPSTA-- 307

  Fly   245 EIPDLDWQVFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKA 309
             :.|           |.::..|     ..||..|..|....:      :|:........::|:.|
  Fly   308 -VVD-----------SIVVGAQ-----GDIRNALINLHLSSL------KGVSSMPTKQLNVSVSA 349

  Fly   310 KTLEFATEYEHRMQSGAKHI--------------------------FH-----LEAFVAQ---FM 340
            |      ..:.:|||..|.|                          .|     .|||..:   |:
  Fly   350 K------GRKKKMQSTLKSIGRDESITLMHALGRVLNPKFNEDKTMLHSPEEITEAFNTEPRNFV 408

  Fly   341 N-IYKKFLSELDMTDD 355
            | :|..:|......||
  Fly   409 NFVYANYLPHFKEIDD 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 77/394 (20%)
Rad17NP_650382.3 Rad17 87..455 CDD:251803 80/406 (20%)
AAA_18 131..>165 CDD:289979 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.