DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and rfc4

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_999902.2 Gene:rfc4 / 406435 ZFINID:ZDB-GENE-040824-3 Length:358 Species:Danio rerio


Alignment Length:364 Identity:102/364 - (28%)
Similarity:160/364 - (43%) Gaps:74/364 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||:.:.::.|.::....|:...:.:|.|:|:||||.|.||.:.|:...||:||..:.|.|
Zfish    35 WVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELYGPDLYRQR 99

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSD-AGMYDRTVVIDLIKQVAQTHQIEISGQR----- 127
            .                       ||:|.|| .|:   .||.:.:|:.|   |:.::|.|     
Zfish   100 V-----------------------LELNASDERGI---QVVREKVKRFA---QLTVAGTRPDGKT 135

  Fly   128 --EFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRV-AAPNE 189
              .||:|::.|.|.:|..||.||||||||...|.|..:..|..||||..:.|||...|. ...|:
Zfish   136 CPPFKIIILDEADSMTSAAQAALRRTMEKESRTTRFCLICNYVSRIIEPLTSRCSKFRFKPLAND 200

  Fly   190 TEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQEIPDLDWQVF 254
            .:...||: .|::|.|....|....:|..||.:||:|:..|::..      ..|.|         
Zfish   201 VQQERILE-ICRKENLKYTTEGVDALVRVSEGDLRKAITFLQSGA------RLNSE--------- 249

  Fly   255 LRETASQIISE---QTPAKL-------------EKIRERLYELLTQGVPPNLIFRGLVEQLVNNC 303
             ||...|.|.|   ..|.|:             ||:...:.:::.||.....:...|.:.::.. 
Zfish   250 -REITEQTIIEIAGVVPPKVIQSLLHICYKGTFEKLEVAVKDMIDQGYAATNLLNQLHDVIIEE- 312

  Fly   304 DMSIKAKTL--EFATEYEHRMQSGAKHIFHLEAFVAQFM 340
            .:|.|.|::  |...|.:..:..||.....|.:..:..|
Zfish   313 QLSDKQKSVITEKMAEVDKCLADGADEYLQLLSLCSVIM 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 102/364 (28%)
rfc4NP_999902.2 rfc 34..346 CDD:234763 101/357 (28%)
AAA 50..196 CDD:99707 58/174 (33%)
AAA_assoc_2 212..>262 CDD:292811 17/65 (26%)
Rep_fac_C 281..348 CDD:285713 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.