DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and RfC4

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster


Alignment Length:354 Identity:89/354 - (25%)
Similarity:152/354 - (42%) Gaps:67/354 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            |::||||.:..::..::|....|.....|.:.|:::..||.|.||.|.|.||.|.:.|...:   
  Fly    18 WIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLGDSYK--- 79

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQIEISGQREFKVIV 133
                          |.:       ||:|.|:....|  ||.:.||..|| .::.:...|. |:::
  Fly    80 --------------EAV-------LELNASNERGID--VVRNKIKMFAQ-QKVTLPRGRH-KIVI 119

  Fly   134 ISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSILQN 198
            :.|.|.:|:.||.|||||||.|.:|.|..::.|::.:||..|:|||..:|....::.::::.|..
  Fly   120 LDEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIE 184

  Fly   199 TCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQEIPDLDWQVFLRETASQII 263
            ..|.|.|....:..:.:|..::.::|:.|..|::........||              |...::.
  Fly   185 VAKWEKLNYTEDGLEAIVFTAQGDMRQGLNNLQSTAQGFGDITA--------------ENVFKVC 235

  Fly   264 SEQTPAKLE---------------KIRERLYELLTQGVPPNLIFRGLVEQLVN-NCDMSIKAKTL 312
            .|..|..||               ||..:|::|   |..|..|...:...... |.|..:|   |
  Fly   236 DEPHPKLLEEMIHHCAANDIHKAYKILAKLWKL---GYSPEDIIANIFRVCKRINIDEHLK---L 294

  Fly   313 EFATEY---EHRMQSGAKHIFHLEAFVAQ 338
            :|..|.   ..::..|...:..|.|.:|:
  Fly   295 DFIREIGITHMKIIDGINSLLQLTALLAK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 89/354 (25%)
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 89/354 (25%)
AAA 31..165 CDD:99707 49/161 (30%)
Rep_fac_C 254..322 CDD:285713 16/73 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11669
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.