DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and Rad17

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001019949.1 Gene:Rad17 / 310034 RGDID:1309515 Length:686 Species:Rattus norvegicus


Alignment Length:394 Identity:80/394 - (20%)
Similarity:151/394 - (38%) Gaps:90/394 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDF----PH----LMFYGPSGAGKKTRIMCLLREMY 60
            |||||:|....:|..||.:.|.:....|....    .|    |:..||.|.||.|.|..|.:|: 
  Rat    90 WVDKYKPETQHELAVHKKKIEEVETWLKTQVLEVKPKHGGSILLITGPPGCGKTTTIKILSKEL- 153

  Fly    61 GSGVERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQIEISG 125
            |..|:...:..:......:.| |:....||:.:....|...:::     |.:.:..:.:::::.|
  Rat   154 GIQVQEWVNPILQDFQKDDYK-ELFNSESNFSVIPYQSQIAVFN-----DFLLRATKYNKLQMLG 212

  Fly   126 Q---REFKVIVISE-GDELTKDAQHALRRTMEKYV--ATCRII------ISVNSTSRII------ 172
            .   .:.|:|::.: .::..:|| :||...:.|||  ..|.::      :|.:|..|::      
  Rat   213 DALTTDKKIILVEDLPNQFYRDA-NALHEILRKYVHIGRCPLVFIVSDSVSGDSNHRLLFPKNIQ 276

  Fly   173 --------------PAIRSRCL-----------GIRVAAPNETEIVSILQNTCKRE--GLALPVE 210
                          |.|..:.|           |.::..||:..:..:.|. |..:  .....::
  Rat   277 EECSVSNISFNPVAPTIMMKFLNRIVTIEASKNGEKITVPNKASLELLCQG-CSGDIRSAINSLQ 340

  Fly   211 LAKRVVDKSERNLRRALLMLEAAKVAKA-------PFTANQEIPDL---DWQVFL---------- 255
            .:....:.|..:.::.:.:...|.::||       ....||||..:   |..:||          
  Rat   341 FSSSKGENSSWSKKKKMSLKSDASISKAKQKRKHNSTLENQEIQAIGGKDVSLFLFRALGKILYC 405

  Fly   256 -RETASQIISEQTPAKL-EKIRERLY----ELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKTLEF 314
             |...:::.|.:.||.| |..|:.|.    |::.....|...|...:.|  |..|.......|..
  Rat   406 KRAPLTELASPRLPAHLSEHDRDTLLVQPEEIVEMSHMPGEFFNLYLHQ--NYIDFFTDVDDLVR 468

  Fly   315 ATEY 318
            |:|:
  Rat   469 ASEF 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 80/394 (20%)
Rad17NP_001019949.1 rad24 13..651 CDD:129690 80/394 (20%)
AAA_18 133..>253 CDD:289979 28/127 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.