DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and Rfc4

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001099339.1 Gene:Rfc4 / 288003 RGDID:1310142 Length:364 Species:Rattus norvegicus


Alignment Length:353 Identity:98/353 - (27%)
Similarity:161/353 - (45%) Gaps:51/353 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||:.:.::.|.::....|:...:.:|.|:|:||||.|.||.:.|:...||::|..:.|||
  Rat    40 WVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLR 104

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDR--TVVIDLIKQVAQTHQIEISGQRE--- 128
            .                       ||:|.||    :|  .||.:.:|..|   |:.:||.|.   
  Rat   105 V-----------------------LELNASD----ERGIQVVREKVKNFA---QLTVSGSRSDGK 139

  Fly   129 ----FKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNE 189
                ||::::.|.|.:|..||.||||||||...|.|..:..|..||||..:.|||...|....::
  Rat   140 PCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSD 204

  Fly   190 TEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQE-----IPDL 249
            ......|.:..::|.:.:..|....:|..||.:||:|:..|::|    ...|..:|     |.|:
  Rat   205 KIQQKRLLDIAEKENVKIGDEEIAYLVRISEGDLRKAITFLQSA----TRLTGGKEISEDVITDI 265

  Fly   250 DWQVFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKTL-- 312
            . .|....|...|::.......:|:...|..|:.:|.....:...|.:.::.:.::|.|.|::  
  Rat   266 A-GVIPAATIEGIVTACHSGSFDKLEAVLKNLIDEGHAATQLVNQLHDSIIEDENLSDKQKSIIT 329

  Fly   313 EFATEYEHRMQSGAKHIFHLEAFVAQFM 340
            |...|.:..:..||.....|.:..|..|
  Rat   330 EKLAEVDKCLADGADEHLQLMSLCATVM 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 98/353 (28%)
Rfc4NP_001099339.1 rfc 39..354 CDD:234763 96/348 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.