DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and Rfc2

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_064406.1 Gene:Rfc2 / 19718 MGIID:1341868 Length:349 Species:Mus musculus


Alignment Length:352 Identity:88/352 - (25%)
Similarity:157/352 - (44%) Gaps:63/352 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||.:|:::..::|....|....::.:.|:::..||.|.||.|.|:||.|.:.|..::   
Mouse    33 WVEKYRPLKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALK--- 94

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPS-DAGMYDRTVVIDLIKQVAQTHQIEISGQREFKVI 132
                                 :..||:|.| |.|:   .||.:.||..||.......|:.  |:|
Mouse    95 ---------------------DAVLELNASNDRGI---DVVRNKIKMFAQQKVTLPKGRH--KII 133

  Fly   133 VISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSILQ 197
            ::.|.|.:|..||.|||||||.|..|.|..::.|::.:||..|:|||..:|.....:.::::.|.
Mouse   134 ILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQVLTRLM 198

  Fly   198 NTCKREGLALPVELAKRVVDKSERNLRRALLMLEAA-------------KVAKAPFTANQEIPDL 249
            |..::|.:....:..:.::..::.::|:||..|::.             ||...|.      |.|
Mouse   199 NVIEKEKVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGYINSENVFKVCDEPH------PLL 257

  Fly   250 DWQVFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKTLEF 314
                     ..::|.....|.:::..:.|..|...|..|..:. |.:.::.....|:...| |||
Mouse   258 ---------VKEMIQHCVDANIDEAYKILAHLWHLGYSPEDVI-GNIFRVCKTFPMAEYLK-LEF 311

  Fly   315 ATE--YEH-RMQSGAKHIFHLEAFVAQ 338
            ..|  |.| ::..|...:..:...:|:
Mouse   312 IKEIGYTHMKVAEGVNSLLQMAGLLAR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 88/352 (25%)
Rfc2NP_064406.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
PLN03025 31..343 CDD:178596 88/352 (25%)
AAA 46..180 CDD:99707 49/162 (30%)
AAA_assoc_2 203..>231 CDD:292811 4/27 (15%)
Rep_fac_C 269..337 CDD:285713 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.