DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and rfc-2

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_500069.1 Gene:rfc-2 / 176946 WormBaseID:WBGene00004338 Length:334 Species:Caenorhabditis elegans


Alignment Length:354 Identity:91/354 - (25%)
Similarity:154/354 - (43%) Gaps:78/354 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALWVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVE 65
            :|.||:||||:.|:.:..:::..|.|:.:..:.:.|:::..||.|.||.|.:..|.||:.|..|:
 Worm     9 LAPWVEKYRPKVLADIVGNENIVERLKVIGHEGNVPNIVLSGPPGCGKTTSVWALARELLGDKVK 73

  Fly    66 RLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQIEISGQREFK 130
                             |.:       ||:|.||....|  ||...||..|||......|:.  |
 Worm    74 -----------------EAV-------LELNASDERGID--VVRHRIKTFAQTKVTLPEGRH--K 110

  Fly   131 VIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSI 195
            :|::.|.|.:|..||.|||||||.|..|.|..::.|.:.:||..|:|||..:|....:..::::.
 Worm   111 IIILDEADSMTDGAQQALRRTMEMYTKTTRFALACNQSEKIIEPIQSRCALLRYTKLSPVQLLTR 175

  Fly   196 LQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAA-------------KVAKAP-------- 239
            ::...|.|.:.......:.::..::.::|:||..|:|.             ||...|        
 Worm   176 VKEVAKAEKVNYDDGGLEAILFTAQGDMRQALNNLQATVNAYELVNKENVLKVCDEPHPDLMIKM 240

  Fly   240 ---------FTANQEIPDLD-------------WQVFLRETASQIISEQTPAKLEKIRE--RLYE 280
                     |.|::.|.:..             ::|......|:.:|||  .::|.||:  ..:.
 Worm   241 LHYCTDRKFFEASKIIHEFHRLGFSSDDIVSTLFRVVKTVELSKNVSEQ--LRMEYIRQIAMCHM 303

  Fly   281 LLTQGVPPNLIFRGLVEQLVNNCDMSIKA 309
            .:.||:...|....|:..|   |.:|..|
 Worm   304 RIVQGLTSKLQLSRLIADL---CRVSAAA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 90/352 (26%)
rfc-2NP_500069.1 PLN03025 11..325 CDD:178596 88/346 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.