DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and rfc-4

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_498521.1 Gene:rfc-4 / 175976 WormBaseID:WBGene00004340 Length:334 Species:Caenorhabditis elegans


Alignment Length:307 Identity:82/307 - (26%)
Similarity:141/307 - (45%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            |.:||||:.|..:.:..:....|:...:..|.|||:||||.|.||.:..:...|:::        
 Worm    17 WTEKYRPKTLDDIAYQDEVVTMLKGALQGRDLPHLLFYGPPGTGKTSAALAFCRQLF-------- 73

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQIEISG--QRE--- 128
                    |.|       :..:..|::|.||    :|.:.:  ::|..|:......|  .||   
 Worm    74 --------PKN-------IFHDRVLDLNASD----ERGIAV--VRQKIQSFSKSSLGHSHREDVL 117

  Fly   129 -FKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRV-AAPNETE 191
             .|:|::.|.|.:|::||.|:||.:|.:..|.|.|:..|..||:||.:.|||...|. :.|.|.:
 Worm   118 KLKIIILDEVDAMTREAQAAMRRVIEDFSKTTRFILICNYVSRLIPPVVSRCAKFRFKSLPAEIQ 182

  Fly   192 IVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQEIPDLDWQVFLR 256
             |..|:..|..||..:..:..|:|::.||.:||||:..|::.    ||...:.:  |.....:||
 Worm   183 -VQRLRTICDAEGTPMSDDELKQVMEYSEGDLRRAVCTLQSL----APILKSGD--DNARNCYLR 240

  Fly   257 ETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNC 303
            .::..::          |......:||..||..:   .|.:.:..:|
 Worm   241 GSSDSLL----------ISNVCKSILTADVPQII---ALTKDITKSC 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 82/307 (27%)
rfc-4NP_498521.1 44 12..329 CDD:222866 82/307 (27%)
AAA 32..169 CDD:99707 45/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.