DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and Rfc2

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_446238.1 Gene:Rfc2 / 116468 RGDID:621198 Length:349 Species:Rattus norvegicus


Alignment Length:352 Identity:89/352 - (25%)
Similarity:157/352 - (44%) Gaps:63/352 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||.:|:::..::|....|....::.:.|:::..||.|.||.|.|:||.|.:.|..::   
  Rat    33 WVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALK--- 94

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPS-DAGMYDRTVVIDLIKQVAQTHQIEISGQREFKVI 132
                                 :..||:|.| |.|:   .||.:.||..||.......|:.  |:|
  Rat    95 ---------------------DAVLELNASNDRGI---DVVRNKIKMFAQQKVTLPKGRH--KII 133

  Fly   133 VISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSILQ 197
            ::.|.|.:|..||.|||||||.|..|.|..::.|::.:||..|:|||..:|.....:.:::|.|.
  Rat   134 ILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQVLSRLM 198

  Fly   198 NTCKREGLALPVELAKRVVDKSERNLRRALLMLEAA-------------KVAKAPFTANQEIPDL 249
            |..::|.:....:..:.::..::.::|:||..|::.             ||...|.      |.|
  Rat   199 NVIEKEKVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGYINSENVFKVCDEPH------PLL 257

  Fly   250 DWQVFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKTLEF 314
                     ..::|.....|.:::..:.|..|...|..|..:. |.:.::.....|:...| |||
  Rat   258 ---------VKEMIQHCVDANIDEAYKILAHLWHLGYSPEDVI-GNIFRVCKTFPMAEYLK-LEF 311

  Fly   315 ATE--YEH-RMQSGAKHIFHLEAFVAQ 338
            ..|  |.| ::..|...:..:...:|:
  Rat   312 IKEIGYTHMKVAEGVNSLLQMAGLLAR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 89/352 (25%)
Rfc2NP_446238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
PLN03025 31..343 CDD:178596 89/352 (25%)
AAA 46..180 CDD:99707 49/162 (30%)
AAA_assoc_2 203..>231 CDD:292811 4/27 (15%)
Rep_fac_C 269..337 CDD:285713 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.