DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC38 and Rfc4

DIOPT Version :9

Sequence 1:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_663455.1 Gene:Rfc4 / 106344 MGIID:2146571 Length:364 Species:Mus musculus


Alignment Length:349 Identity:97/349 - (27%)
Similarity:159/349 - (45%) Gaps:43/349 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68
            ||:||||:.:.::.|..:....||...:.:|.|:|:||||.|.||.:.|:...||::|..:.|||
Mouse    40 WVEKYRPKCVDEVAFQDEVVAVLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLR 104

  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDR--TVVIDLIKQVAQTHQIEISGQRE--- 128
            .                       ||:|.||    :|  .||.:.:|..|   |:.:||.|.   
Mouse   105 V-----------------------LELNASD----ERGIQVVREKVKNFA---QLTVSGSRSDGK 139

  Fly   129 ----FKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNE 189
                ||::::.|.|.:|..||.||||||||...|.|..:..|..||||..:.|||...|....::
Mouse   140 PCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSD 204

  Fly   190 TEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAA-KVAKAPFTANQEIPDLDWQV 253
            ......|.:..::|.:.:..|....:|..||.:||:|:..|::| ::......:...|.|:. .|
Mouse   205 KIQQERLLDIAEKENVKIGNEEIAYLVKISEGDLRKAITFLQSATRLTGGKEVSEDVITDIA-GV 268

  Fly   254 FLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKTL--EFAT 316
            ....|...|.:.......:|:...:..|:.:|.....:...|.:.::.|.::|.|.|::  |...
Mouse   269 IPAATIDGIFTACHSGSFDKLEAVVKNLIDEGHAATQLVNQLHDAIIENENLSDKHKSIITEKLA 333

  Fly   317 EYEHRMQSGAKHIFHLEAFVAQFM 340
            |.:..:..||.....|.:..|..|
Mouse   334 EVDKCLADGADEHLQLMSLCATVM 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC38NP_001285833.1 rfc 3..345 CDD:234763 97/349 (28%)
Rfc4NP_663455.1 rfc 39..354 CDD:234763 95/344 (28%)
AAA 55..201 CDD:99707 59/175 (34%)
AAA_assoc_2 217..>267 CDD:292811 12/50 (24%)
Rep_fac_C 285..354 CDD:285713 13/68 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.