DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csl4 and exos-1

DIOPT Version :9

Sequence 1:NP_609492.1 Gene:Csl4 / 34548 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_499416.1 Gene:exos-1 / 176532 WormBaseID:WBGene00012966 Length:208 Species:Caenorhabditis elegans


Alignment Length:209 Identity:71/209 - (33%)
Similarity:111/209 - (53%) Gaps:20/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ETVVCLPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNIEDSGDK----CQVVSVHKPGFHL- 66
            ||:|. ||:::........:|.|.||.|..|:||.:|.||:....||    .||:.|.:....| 
 Worm     4 ETLVA-PGDKVLDAIGEYRMGKGLYEANRRIFASVAGFVNVYGFRDKSDNLVQVIEVRRSEDQLD 67

  Fly    67 --TIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSF-RP 128
              .:|..|.:|||:|:....:||||.|..:.:.:.:..:..||.|:.:|..|.:..:.:|:| ||
 Worm    68 NELLPFHGAIVTAKVMAVGLRFAKCDIISIGDKVYKKRFSALLPKKKLRPLEPELSEPFKNFVRP 132

  Fly   129 GDVILARVIN--QLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKV 191
            .|.|||:|..  :::..|:|:.||:|||||:...    :...||..|.|:.:...:|...||||:
 Worm   133 NDYILAKVCEDAEIKDKFVLSIAEDELGVVLCRG----RFGEPMQKVDWNTVVSTRTGKTEPRKM 193

  Fly   192 AKV-----LPESSI 200
            |||     ||..|:
 Worm   194 AKVPQKCTLPTQSV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 63/192 (33%)
ECR1_N 10..47 CDD:291080 13/36 (36%)
S1_CSL4 66..156 CDD:240217 33/95 (35%)
exos-1NP_499416.1 Csl4 5..195 CDD:224021 64/194 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162631
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9359
Inparanoid 1 1.050 97 1.000 Inparanoid score I3609
Isobase 1 0.950 - 0 Normalized mean entropy S1914
OMA 1 1.010 - - QHG55393
OrthoDB 1 1.010 - - D1200489at2759
OrthoFinder 1 1.000 - - FOG0004386
OrthoInspector 1 1.000 - - oto18394
orthoMCL 1 0.900 - - OOG6_101821
Panther 1 1.100 - - LDO PTHR12686
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R252
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.