DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csl4 and exosc1

DIOPT Version :9

Sequence 1:NP_609492.1 Gene:Csl4 / 34548 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001123851.1 Gene:exosc1 / 100170616 XenbaseID:XB-GENE-1007857 Length:194 Species:Xenopus tropicalis


Alignment Length:190 Identity:92/190 - (48%)
Similarity:131/190 - (68%) Gaps:9/190 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLPGERLCRTEDSIVLGIGTYEQNGYIYASKSG-IVNIEDSGDKCQVVSVHKPGFHLTIPATGDV 74
            |:||||||.||| ...|.||:.::|||:||.:| ||...|:|....:..|.:...|| :|..|.|
 Frog     7 CVPGERLCSTED-CAPGYGTFCRHGYIFASLAGYIVKKTDNGLMPVISVVRETDSHL-LPDVGSV 69

  Fly    75 VTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSFRPGDVILARVIN- 138
            ||.:|.....:|||..|..:.:..|.:::||.:||||:|.||||:|::||||||||:::|:||: 
 Frog    70 VTCKVTSINSRFAKVQIMYIGSTPLSNTFRGTIRKEDIRATEKDKVEVYKSFRPGDIVMAKVISL 134

  Fly   139 -QLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKVAKVLPE 197
             .::.::||:|||||||||:|::    :....|||:.|.|||||:|.|||.||||:|.||
 Frog   135 GDIQSNYLLSTAENELGVVVAHS----EAGATMVPISWCEMQCPKTHIKEQRKVARVQPE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 88/184 (48%)
ECR1_N 10..47 CDD:291080 21/36 (58%)
S1_CSL4 66..156 CDD:240217 44/91 (48%)
exosc1NP_001123851.1 ECR1_N 7..40 CDD:379589 19/33 (58%)
S1_CSL4 61..153 CDD:240217 45/92 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9632
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9359
Inparanoid 1 1.050 171 0.133 Inparanoid score I3985
OMA 1 1.010 - - QHG55393
OrthoDB 1 1.010 - - D1200489at2759
OrthoFinder 1 1.000 - - FOG0004386
OrthoInspector 1 1.000 - - oto105524
Panther 1 1.100 - - LDO PTHR12686
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R252
SonicParanoid 1 1.000 - - X4766
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.