DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and TMTC4

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001337500.1 Gene:TMTC4 / 84899 HGNCID:25904 Length:818 Species:Homo sapiens


Alignment Length:131 Identity:31/131 - (23%)
Similarity:49/131 - (37%) Gaps:32/131 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVLLPQYL-KFNN-PPIFFERHLAQEIDEMASFCRIFKNEARIVLVKKE-KGLWPEMFQKLDKEA 88
            |.|.|:|: ..|| ..|..||:..||.:|:.|..         |.::.: ...|..:       .
Human   586 VRLNPKYVHAMNNLGNILKERNELQEAEELLSLA---------VQIQPDFAAAWMNL-------G 634

  Fly    89 LMQ---KRLEIADLIVERNKKRDEKALERYDNKRRAEIQKEIQRETDMRERVKQFQENSVREALV 150
            ::|   ||.|.|:.......|...|..:.|.|..|  :..::.|..|..        |:.|.|.|
Human   635 IVQNSLKRFEAAEQSYRTAIKHRRKYPDCYYNLGR--LYADLNRHVDAL--------NAWRNATV 689

  Fly   151 V 151
            :
Human   690 L 690

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 15/56 (27%)
TMTC4NP_001337500.1 DUF1736 369..443 CDD:369859
TPR 558..794 CDD:223533 31/131 (24%)