DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and ODAD4

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_113609.1 Gene:ODAD4 / 83538 HGNCID:25280 Length:672 Species:Homo sapiens


Alignment Length:178 Identity:45/178 - (25%)
Similarity:71/178 - (39%) Gaps:47/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QISQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRIFKNEARI 67
            |.::.|.||:..:..:.||. :..|.|.......||    ||:.|     |.|..  :..|||:.
Human   425 QCAEEEGDIEWQLNASVLVA-QAQVKLRDFESAVNN----FEKAL-----ERAKL--VHNNEAQQ 477

  Fly    68 VLVK----KEKGLWPEMFQKLDKEALMQKRLEIADLIVERNKKRDEKALERYDNKRRAEIQKEIQ 128
            .::.    ..||:..|: :|.:              .||..|::.|.....|::       :.|.
Human   478 AIISALDDANKGIIREL-RKTN--------------YVENLKEKSEGEASLYED-------RIIT 520

  Fly   129 RETDMRERVKQFQENSVREALVVDVRKEAKATPKPD-----TLQYPPS 171
            ||.||| ||:...|..|::   .|..::.|.|.:.|     .||.|.|
Human   521 REKDMR-RVRDEPEKVVKQ---WDHSEDEKETDEDDEAFGEALQSPAS 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 20/80 (25%)
ODAD4NP_113609.1 TPR 1. /evidence=ECO:0000255 13..46
TPR_11 16..78 CDD:290150
TPR repeat 16..41 CDD:276809
TPR repeat 46..76 CDD:276809
TPR 2. /evidence=ECO:0000255 48..80
TPR_11 49..112 CDD:290150
TPR 3. /evidence=ECO:0000255 81..114
TPR repeat 81..109 CDD:276809
TPR 4. /evidence=ECO:0000255 275..311
TPR repeat 311..349 CDD:276809
TPR_12 316..385 CDD:290160
TPR 5. /evidence=ECO:0000255 320..353
TPR 6. /evidence=ECO:0000255 360..393
TPR repeat 360..385 CDD:276809
TPR_12 361..429 CDD:290160 1/3 (33%)
TPR 7. /evidence=ECO:0000255 397..430 1/4 (25%)
TPR_12 398..468 CDD:290160 14/52 (27%)
TPR repeat 431..465 CDD:276809 11/43 (26%)
TPR 8. /evidence=ECO:0000255 437..470 11/44 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 527..672 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.