DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and ifit14

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001287802.1 Gene:ifit14 / 794786 ZFINID:ZDB-GENE-131120-20 Length:433 Species:Danio rerio


Alignment Length:143 Identity:32/143 - (22%)
Similarity:58/143 - (40%) Gaps:26/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VQISQTEEDI----KISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRIFK 62
            ||....:|:|    |.||....||    .:..:.:|.|    .|.:.|    .|:|:.....||.
Zfish   223 VQGENVDEEIQSLLKKSISTANLV----GLNYIIEYFK----GISYGR----AIEEVQRVREIFP 275

  Fly    63 NEARIVLVKKEKGLWPEMFQKLD---KEALMQKRLEIADLIVER-----NKKRDEKALERY--DN 117
            :.:.::.:......|.....|.|   :...:||.:|:.:.:|..     ..:.|..:|.||  :.
Zfish   276 SSSTLLKILANLYKWKVFSMKEDSRERRIWVQKSIELFEEVVRHYPDCVKGRSDLASLHRYAHNT 340

  Fly   118 KRRAEIQKEIQRE 130
            :|..||.:::..|
Zfish   341 ERAEEIYQQLLSE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 16/80 (20%)
ifit14NP_001287802.1 TPR_12 47..120 CDD:290160
TPR repeat 248..272 CDD:276809 6/31 (19%)
TPR repeat 277..319 CDD:276809 7/41 (17%)
TPR repeat 324..352 CDD:276809 7/27 (26%)
TPR repeat 358..392 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.