DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Tmtc4

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001347527.1 Gene:Tmtc4 / 70551 MGIID:1921050 Length:741 Species:Mus musculus


Alignment Length:162 Identity:35/162 - (21%)
Similarity:59/162 - (36%) Gaps:40/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KISIELNRLVTR----KPDVVLLPQY-LKFNNPPIFFER--HLAQEIDEMASFCRIFKNEARIVL 69
            ::..:|||.|..    :...||.|:: |.:||..|..:.  :|||        ......|| :.|
Mouse   592 RLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQ--------AEAVGREA-LQL 647

  Fly    70 VKKEKGLWPEMFQKLDKEALMQKRLEIADLIVERNKKRDEKA---------LERYDNKRRAEIQK 125
            :..:..|   ||...:.....||..|...|.::..|.....|         ..|:.:...|:...
Mouse   648 IPNDHSL---MFSLANVLGKSQKYKESEALFLKAIKANPNVASYHGNLAVLYHRWGHLDSAKKHY 709

  Fly   126 EIQRETD------------MRERVKQFQENSV 145
            ||..:.|            :|.:::|.|:..|
Mouse   710 EISLQLDPVAVGTKENYSLLRRKLEQTQKKDV 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 18/75 (24%)
Tmtc4NP_001347527.1 DUF1736 292..366 CDD:369859
TPR 1 448..481
TPR 481..717 CDD:223533 30/136 (22%)
TPR 2 482..515
TPR repeat 482..510 CDD:276809
TPR repeat 515..545 CDD:276809
TPR 3 517..549
TPR 4 550..583
TPR repeat 550..578 CDD:276809
TPR 5 584..617 7/24 (29%)
TPR repeat 584..610 CDD:276809 4/17 (24%)
TPR repeat 618..646 CDD:276809 9/36 (25%)
TPR 6 619..651 10/40 (25%)
TPR repeat 651..681 CDD:276809 7/32 (22%)
TPR 7 652..685 8/35 (23%)
TPR 8 686..719 6/32 (19%)
TPR repeat 686..714 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.