DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and SPAG1

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_016869243.1 Gene:SPAG1 / 6674 HGNCID:11212 Length:961 Species:Homo sapiens


Alignment Length:241 Identity:53/241 - (21%)
Similarity:84/241 - (34%) Gaps:93/241 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LPQYLKFNNPPIFFERHLAQEIDEMASFCRIFKNEARIVLVKKEKGLWPEMFQKLDK-------- 86
            ||..:.:||                       :.:|.|.|..     |...||..:|        
Human   274 LPTVVAYNN-----------------------RAQAEIKLQN-----WNSAFQDCEKVLELEPGN 310

  Fly    87 -EALMQKRLEIADLIVERNKKRD-----EKALE-RYDN----KRRAEIQKEI-------QRETDM 133
             :||:::    |.....:||.|:     .|.|: ..||    |..:|:::::       :.:|..
Human   311 VKALLRR----ATTYKHQNKLREATEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTKG 371

  Fly   134 RERVKQFQENSVREALVVDVRKEAKATPKPDT---LQYPPSSGGASRLATPLMRPPMSSVRGSGR 195
            :..|.|..|||..|        |.|:..|.:.   .:.|....||:|.|.|.:         .|.
Human   372 KRMVIQEIENSEDE--------EGKSGRKHEDGGGDKKPAEPAGAARAAQPCV---------MGN 419

  Fly   196 INVNFTTQHK------RVTPKR--ESQAAMEK-------AYAAAGG 226
            |....|.:.:      |..|:|  ..:|..:|       |.|||||
Human   420 IQKKLTGKAEGGKRPARGAPQRGQTPEAGADKRSPRRASAAAAAGG 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 8/50 (16%)
SPAG1XP_016869243.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.