DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Ifit3b

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006527327.1 Gene:Ifit3b / 667370 MGIID:3698419 Length:428 Species:Mus musculus


Alignment Length:118 Identity:24/118 - (20%)
Similarity:42/118 - (35%) Gaps:24/118 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LVKKEKGLWPEMFQKLDKEALMQKRLEIADLIVERNKK-----------------RDEKALERYD 116
            |:|...|..|.....|.|.|...|:....|..:|...|                 |..:.||:..
Mouse   254 LIKDALGKAPNQTDVLQKAAQFYKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQLQ 318

  Fly   117 NKRRAEIQKEIQRETDMRERVKQFQENSVREALVVDVRKEAKATPKPDTLQYP 169
            ||..|:..:..||..::|....:|.:.:::       |:.:......|.:.:|
Mouse   319 NKGDADSSERRQRMAELRRLTMEFMQKTLQ-------RRRSPLNSYSDLIDFP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 4/11 (36%)
Ifit3bXP_006527327.1 TPR repeat 76..104 CDD:276809
PEP_TPR_lipo <81..>325 CDD:274350 17/70 (24%)
TPR repeat 109..148 CDD:276809
TPR repeat 161..189 CDD:276809
TPR repeat 194..227 CDD:276809
TPR repeat 266..294 CDD:276809 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.