powered by:
Protein Alignment CG14921 and FKBPL
DIOPT Version :9
Sequence 1: | NP_609491.1 |
Gene: | CG14921 / 34547 |
FlyBaseID: | FBgn0032345 |
Length: | 240 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_071393.2 |
Gene: | FKBPL / 63943 |
HGNCID: | 13949 |
Length: | 349 |
Species: | Homo sapiens |
Alignment Length: | 51 |
Identity: | 14/51 - (27%) |
Similarity: | 30/51 - (58%) |
Gaps: | 4/51 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 130 ETDMRERVKQFQENSVREAL--VVDVRKEAKATPKPDTLQYPPSSGGASRL 178
|.|..:..:::::| :||.| |:.:|::.: .|..:||:...|...||::
Human 11 EKDTSQPQQEWEKN-LRENLDSVIQIRQQPR-DPPTETLELEVSPDPASQI 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1124 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.