DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and FKBPL

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_071393.2 Gene:FKBPL / 63943 HGNCID:13949 Length:349 Species:Homo sapiens


Alignment Length:51 Identity:14/51 - (27%)
Similarity:30/51 - (58%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ETDMRERVKQFQENSVREAL--VVDVRKEAKATPKPDTLQYPPSSGGASRL 178
            |.|..:..:::::| :||.|  |:.:|::.: .|..:||:...|...||::
Human    11 EKDTSQPQQEWEKN-LRENLDSVIQIRQQPR-DPPTETLELEVSPDPASQI 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226
FKBPLNP_071393.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..55 5/19 (26%)
TPR_11 187..>348 CDD:330823
TPR 1 210..243
TPR repeat 210..238 CDD:276809
TPR repeat 251..281 CDD:276809
TPR 2 252..285
TPR 3 286..319
TPR repeat 286..314 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.