DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and BBS4

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_149017.2 Gene:BBS4 / 585 HGNCID:969 Length:519 Species:Homo sapiens


Alignment Length:161 Identity:34/161 - (21%)
Similarity:61/161 - (37%) Gaps:52/161 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LEIADLIVERNKKRDEKALERY-DNKRRAEIQKE---IQRETDMRERVKQF-QENSVREALV--- 150
            |..|.|:..:.:|::  ||.:| :.:::..:.|:   ::.:::|.|..::. ....|.||||   
Human   376 LNYAVLLYNQGEKKN--ALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTK 438

  Fly   151 ----VDVRKEAKATPKPDTLQYP--------------------PS-SGGASRLATPLMRP--PMS 188
                ...:.:..:|.||.:.|.|                    || :||.|:...|...|  |..
Human   439 PVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEP 503

  Fly   189 SVRGSGRINVNFTTQHKRVTPKRESQAAMEK 219
            :|..|               |...|:...||
Human   504 AVESS---------------PTETSEQIREK 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226
BBS4NP_149017.2 Required for localization to centrosomes 1..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
TPR_11 <18..400 CDD:330823 7/25 (28%)
TPR repeat 36..61 CDD:276809
TPR 1 67..100
TPR repeat 68..95 CDD:276809
Interaction with PCM1. /evidence=ECO:0000269|PubMed:15107855 101..337
TPR repeat 101..129 CDD:276809
TPR repeat 134..164 CDD:276809
TPR repeat 169..196 CDD:276809
TPR repeat 202..229 CDD:276809
TPR repeat 236..264 CDD:276809
TPR repeat 270..298 CDD:276809
TPR repeat 303..333 CDD:276809
Required for localization to centrosomes 338..519 32/159 (20%)
TPR repeat 338..365 CDD:276809
TPR repeat 372..397 CDD:276809 7/22 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 440..519 17/93 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.