DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and kdm6a

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_005167851.1 Gene:kdm6a / 569277 ZFINID:ZDB-GENE-081105-56 Length:1452 Species:Danio rerio


Alignment Length:180 Identity:40/180 - (22%)
Similarity:65/180 - (36%) Gaps:20/180 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDVVLLPQYLKFN--NPPIFFERHLAQEIDEMASFCRIFKNEARIVLVKKEKGLWPEMFQKLDKE 87
            |.:..||:. |.|  .|.|:.|.........:..||....|...::     :||...:  |||..
Zfish   977 PPIPPLPKD-KLNPPTPSIYLENKRDAFFPPLHQFCTNTANPVTVI-----RGLAGAL--KLDLG 1033

  Fly    88 ALMQKRLEIA--DLIVERNKKRDEKALERYD-NKRRAEIQKEIQRETDMRERVKQFQENSVREAL 149
            ....|.|..|  :.:||...:..:...|.:| ...|...:.|..|......|..|:|.:|.:|:|
Zfish  1034 LFSTKTLVEANPEHLVEVRTQLSQPTDENWDVTGSRKMWRCESSRSHTTIARYAQYQASSFQESL 1098

  Fly   150 VVDVRKEAKATPKPDTLQYPPSSGGASRLATPLMRPPMSSVRGSGRINVN 199
            ..:  .|.|........:..||.....|     .|.|...::....|:::
Zfish  1099 REE--NEKKGQKDHSDTESAPSENVVRR-----RRGPFKHIKFGTNIDLS 1141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 13/57 (23%)
kdm6aXP_005167851.1 TPR 74..332 CDD:223533
TPR repeat 95..123 CDD:276809
TPR repeat 131..176 CDD:276809
TPR repeat 181..211 CDD:276809
TPR repeat 222..250 CDD:276809
TPR repeat 260..295 CDD:276809
TPR_17 289..320 CDD:290167
TPR_11 302..365 CDD:290150
TPR repeat 302..329 CDD:276809
TPR repeat 334..364 CDD:276809
TPR_1 335..368 CDD:278916
TPR repeat 369..395 CDD:276809
SSDP 572..852 CDD:282372
JmjC 1149..1213 CDD:214721
JmjC 1183..1291 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.