DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and kdm6al

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_005168853.1 Gene:kdm6al / 569207 ZFINID:ZDB-GENE-070112-2002 Length:1356 Species:Danio rerio


Alignment Length:170 Identity:35/170 - (20%)
Similarity:68/170 - (40%) Gaps:44/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TEEDIKISI---ELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLA---QEIDEMASFC--RIFKN 63
            |....|:::   |.|:|.:.|..|.::  :|.:|     ..|::.   |.:.||..||  |..:.
Zfish  1199 TAHQYKLAVERYEWNKLQSVKSMVPMV--HLSWN-----MARNIKVADQRLFEMIKFCLLRTLRQ 1256

  Fly    64 EARIVLVKKEKGLWPEMFQKLDKEALMQKR-------------LEIADLIV---ERNKKRDEKAL 112
            ...|          .|......||.|.|:|             :|:.:|:.   |.:..|...|:
Zfish  1257 TQSI----------RESLLSAGKETLWQRRSRDEPAHYCSVCEVEVWNLLFVCSEGSPCRPAAAV 1311

  Fly   113 ERYDNKRRAEIQKE---IQRETDMRERVKQFQENSVREAL 149
            :..|..|:|.:..:   :.::..|.:..:.:::.|:..||
Zfish  1312 QCQDCARKASVDLQGFVVLQQFRMEDLTQLYEQFSLAPAL 1351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 18/81 (22%)
kdm6alXP_005168853.1 TPR_11 92..161 CDD:290150
TPR repeat 93..121 CDD:276809
TPR_11 129..194 CDD:290150
TPR repeat 129..159 CDD:276809
TPR_1 130..163 CDD:278916
TPR repeat 164..194 CDD:276809
TPR repeat 205..233 CDD:276809
TPR repeat 243..278 CDD:276809
TPR_17 272..303 CDD:290167
TPR_11 285..348 CDD:290150
TPR repeat 285..312 CDD:276809
TPR repeat 317..347 CDD:276809
TPR_1 318..351 CDD:278916
TPR repeat 352..378 CDD:276809
JmjC 1053..1117 CDD:214721
JmjC 1087..1195 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.