DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Ifit1

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_064481.1 Gene:Ifit1 / 56824 RGDID:620599 Length:463 Species:Rattus norvegicus


Alignment Length:134 Identity:29/134 - (21%)
Similarity:51/134 - (38%) Gaps:39/134 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QISQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRIF--KNEA 65
            |..:.|.:.:.::.||.||.                       |:.|:|.......:.|  |:|.
  Rat   344 QYEEAEGNFQEALNLNNLVA-----------------------HIEQDIHFRYGRSQQFHKKSED 385

  Fly    66 RIV------LVKKEKGL-WPEMFQKLDKEALMQKR-----LEIADL--IVERNKKRDEKALERYD 116
            :.:      |..:||.. |.::...|:|.|..:.|     :|...|  :|.:.|.::.|||..|:
  Rat   386 KAITHYLKGLKLEEKSFAWRKLLTALEKVAERRVRQNVRLVESTSLLGLVFKLKGQEMKALLYYE 450

  Fly   117 NKRR 120
            ...|
  Rat   451 KALR 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 15/85 (18%)
Ifit1NP_064481.1 TPR repeat 136..166 CDD:276809
Coatomer_E 158..421 CDD:252768 19/99 (19%)
TPR repeat 171..203 CDD:276809
TPR repeat 208..236 CDD:276809
TPR repeat 242..270 CDD:276809
TPR repeat 275..324 CDD:276809
TPR repeat 329..356 CDD:276809 2/11 (18%)
TPR repeat 363..396 CDD:276809 6/55 (11%)
TPR repeat 426..454 CDD:276809 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.