DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14921 and spag1a

DIOPT Version :9

Sequence 1:	NP_609491.1	Gene:	CG14921 / 34547	FlyBaseID:	FBgn0032345	Length:	240	Species:	Drosophila melanogaster
Sequence 2:	NP_001082875.2	Gene:	spag1a / 564953	ZFINID:	ZDB-GENE-030131-9443	Length:	386	Species:	Danio rerio

Alignment Length:	105	Identity:	22/105 - (20%)
Similarity:	47/105 - (44%)	Gaps:	22/105 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    58 CRIFKNEARIVLVKKEKGLWPEMFQKLDKEALMQKRLEIADLIVERNKKR------DEKALERYD 116
            |.|:.|.|.             .|.||::.|..::..:.|..:..:|||.      ..|.|:.|
Zfish   295 CAIYTNRAL-------------CFLKLERFAEAKQDCDSALQMEPKNKKAFYRRALAHKGLKDY- 345

  Fly   117 NKRRAEIQKEIQRETDMRERVKQFQ--ENSVREALVVDVR 154
            .....::|:.:|.:.:::|..::.:  .|.:||:|:.:.:
Zfish   346 LSASTDLQEVLQLDPNVQEAEQELEMVTNLLRESLLANAQ 385

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14921	NP_609491.1	p23_DYX1C1_like	4..81	CDD:107226	4/22 (18%)
spag1a	NP_001082875.2	TPR_11	87..157	CDD:290150
		TPR repeat	87..112	CDD:276809
		TPR repeat	125..155	CDD:276809
		TPR_11	128..190	CDD:290150
		TPR repeat	160..188	CDD:276809
		TPR_11	263..326	CDD:290150	9/43 (21%)
		TPR repeat	263..289	CDD:276809
		TPR repeat	294..324	CDD:276809	9/41 (22%)
		TPR_11	297..360	CDD:290150	16/76 (21%)
		TPR_1	297..328	CDD:278916	8/43 (19%)
		TPR repeat	329..357	CDD:276809	6/28 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900