DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and tmtc2a

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001124075.1 Gene:tmtc2a / 564667 ZFINID:ZDB-GENE-041210-299 Length:844 Species:Danio rerio


Alignment Length:136 Identity:26/136 - (19%)
Similarity:48/136 - (35%) Gaps:61/136 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 MFQKLDKEALMQKRLEI-----------ADLIVERNKKRD-----EKALERYDNK---------- 118
            |.||.:.|....|.:|:           ...::|.::..:     :||.| .||:          
Zfish   698 MGQKSEAERYFLKAIELDPARGNCYMHYGQFLLEESRLAEAAAMAQKAAE-LDNEEFDVVFSAAH 761

  Fly   119 --RRAEIQKEIQ----RETDMRE-----------------RVKQFQENSVREALVVDVRKEAKAT 160
              |:|.:.:|.:    :..|:|.                 ::|:.:.|.:| ||.:         
Zfish   762 MLRQASLNEEAETYYGKAADLRPDHPAALMNLGAILHLNGKLKEAESNYLR-ALQL--------- 816

  Fly   161 PKPDTL 166
             |||.|
Zfish   817 -KPDDL 821

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity