| Sequence 1: | NP_609491.1 | Gene: | CG14921 / 34547 | FlyBaseID: | FBgn0032345 | Length: | 240 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
| Alignment Length: | 226 | Identity: | 36/226 - (15%) |
|---|---|---|---|
| Similarity: | 68/226 - (30%) | Gaps: | 92/226 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 QISQTEEDIKISIE---------LNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFC 58
Fly 59 RIFKNEARIVLVKK------------------EKGLWPEMFQKLDKEALMQKRLEIAD------- 98
Fly 99 -----LIVERN---------------KK-----------------------RDEKALERYDNKRR 120
Fly 121 AEIQKEIQRETDMRERVKQFQENSVREALVV 151 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14921 | NP_609491.1 | p23_DYX1C1_like | 4..81 | CDD:107226 | 14/103 (14%) |
| CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
| TPR | 442..701 | CDD:223533 | 34/222 (15%) | ||
| TPR_1 | 444..477 | CDD:278916 | |||
| TPR repeat | 444..472 | CDD:276809 | |||
| TPR_17 | 466..499 | CDD:290167 | 2/5 (40%) | ||
| TPR repeat | 480..506 | CDD:276809 | 5/12 (42%) | ||
| TPR repeat | 511..541 | CDD:276809 | 4/36 (11%) | ||
| TPR_1 | 512..545 | CDD:278916 | 5/43 (12%) | ||
| TPR_1 | 546..577 | CDD:278916 | 3/30 (10%) | ||
| TPR repeat | 546..574 | CDD:276809 | 3/27 (11%) | ||
| TPR repeat | 580..608 | CDD:276809 | 6/27 (22%) | ||
| TPR repeat | 614..642 | CDD:276809 | 3/27 (11%) | ||
| TPR repeat | 647..677 | CDD:276809 | 5/33 (15%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||