DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and odad4

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_956610.1 Gene:odad4 / 393286 ZFINID:ZDB-GENE-040426-995 Length:486 Species:Danio rerio


Alignment Length:290 Identity:53/290 - (18%)
Similarity:91/290 - (31%) Gaps:89/290 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QISQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRIFKNEARI 67
            |:.|..|.:|........:|.:||           |......|          |.|.:...:|..
Zfish    23 QLFQRGEYVKAVESFTTALTLQPD-----------NKNCLVSR----------SRCYVKLGDAEN 66

  Fly    68 VL------VKKEKGLWPEMFQKLDKEAL-MQKRLEIADLIVER-NKKRDE---------KALERY 115
            .|      :|..|..:..::||  .||| .....|.|.:...| :|.|.|         ||.|..
Zfish    67 ALKDAESSLKDNKNYFKGLYQK--AEALYTMGDFEFALVYYHRGHKLRPELQEFRLGIQKAQEAI 129

  Fly   116 DNKRRAEIQKEIQRETDMRERVKQFQENSVR-EALVVDVRKEAKATPKPDTLQYPPSSGGASRLA 179
            ||...:....::..:.|:     .|..|.|. :.|....:||:|        ::...:....:.|
Zfish   130 DNSVGSPSSVKLVNKGDL-----SFFHNGVHPQNLNPSNKKESK--------KHSKKTDKGEKTA 181

  Fly   180 TPLMRPPMS-----------------SVRGSGRI-------------NVNFTTQHKRVTPKRESQ 214
            ..|:....|                 .:|...|:             .:.|..|.|.:..::..:
Zfish   182 KQLLGELYSDREYLKKLLQDEDLVKCKIRSGERVQDLIVGSISYLDTRMAFWQQQKPIYARQRDR 246

  Fly   215 AAMEKAYAAA-----GGPNANVQSPMESVD 239
            ..|::.::..     ..|...|.|.:|.:|
Zfish   247 KLMQQQWSKVLHKPPSDPTRYVLSSLEEID 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 14/82 (17%)
odad4NP_956610.1 TPR 1. /evidence=ECO:0000255 14..47 7/34 (21%)
TPR_11 16..79 CDD:290150 14/76 (18%)
TPR repeat 16..42 CDD:276809 4/18 (22%)
TPR repeat 47..77 CDD:276809 6/39 (15%)
TPR 2. /evidence=ECO:0000255 49..81 7/41 (17%)
TPR_11 50..113 CDD:290150 16/74 (22%)
TPR 3. /evidence=ECO:0000255 82..115 10/34 (29%)
TPR repeat 82..110 CDD:276809 8/29 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..180 5/34 (15%)
TPR_12 313..379 CDD:290160
TPR 4. /evidence=ECO:0000255 314..347
TPR repeat 316..342 CDD:276809
TPR repeat 347..383 CDD:276809
TPR 5. /evidence=ECO:0000255 354..387
TPR_12 355..423 CDD:290160
TPR 6. /evidence=ECO:0000255 391..424
TPR 7. /evidence=ECO:0000255 431..464
TPR repeat 431..459 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.