DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Tmtc3

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster


Alignment Length:136 Identity:33/136 - (24%)
Similarity:59/136 - (43%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KFNNPPIFFERHLAQEIDEMASFC---RIFKN-----EARIVLVKKEKGLWPEMFQKLDKEALMQ 91
            ||....::|::.:..:.|::.:..   |.|.|     ||....| :.|.|:|:....:...|.:.
  Fly   529 KFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYV-QAKALFPQAKPGVSYHARIA 592

  Fly    92 KR-----LEIADLIVERNKKRDEKALERYD---NKRRAEIQKEIQRETDMRE--RVKQFQENSVR 146
            ..     :.:|:||. :|:.|.|:|...|.   :.|...:|..|.|...:.:  |..|.|| ...
  Fly   593 PNHLNVFINLANLIA-KNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQE-VYE 655

  Fly   147 EALVVD 152
            :||:.|
  Fly   656 QALLYD 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 13/53 (25%)
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 33/136 (24%)
TPR repeat 514..542 CDD:276809 3/12 (25%)
TPR repeat 547..591 CDD:276809 10/44 (23%)
TPR repeat 598..625 CDD:276809 8/27 (30%)
TPR repeat 630..660 CDD:276809 9/30 (30%)
TPR repeat 665..693 CDD:276809
TPR repeat 737..764 CDD:276809
TPR repeat 803..834 CDD:276809
TPR repeat 839..867 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.