DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and Kdm6b

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_038942397.1 Gene:Kdm6b / 363630 RGDID:1307629 Length:1636 Species:Rattus norvegicus


Alignment Length:159 Identity:36/159 - (22%)
Similarity:71/159 - (44%) Gaps:47/159 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EARIVLVKKEKGLWPEMFQKLDKEALM-----QKRLEIADLIV----------ERNKKRDEKALE 113
            |.:|.|:|.|.|         |||..:     ::||.:|||.:          .:|.|...|..|
  Rat  1094 ELKIRLIKVESG---------DKETFIASEVEERRLRMADLTISHCAADVMRASKNAKVKGKFRE 1149

  Fly   114 RYDNKRRAEIQKEIQRETDMRERVKQFQENSVREALVVDVRKEAKATPKPDTLQYPPSSGGASRL 178
            .|.:..:: ::.:|..|    |::.:.:.|....::.::.:::|.:   |..||:         .
  Rat  1150 SYLSPAQS-VKPKINTE----EKLPREKLNPPTPSIYLESKRDAFS---PVLLQF---------C 1197

  Fly   179 ATPLMRPPMSSVRG-SGRINVN---FTTQ 203
            ..|  |.|::.:|| :|.:.:|   |:|:
  Rat  1198 TDP--RNPITVIRGLAGSLRLNLGLFSTK 1224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 6/16 (38%)
Kdm6bXP_038942397.1 TPR repeat 106..136 CDD:276809
JmjC 1336..1400 CDD:214721
JmjC 1370..1478 CDD:396791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.