| Sequence 1: | NP_609491.1 | Gene: | CG14921 / 34547 | FlyBaseID: | FBgn0032345 | Length: | 240 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001007011.1 | Gene: | Dnaaf4 / 363096 | RGDID: | 1549760 | Length: | 420 | Species: | Rattus norvegicus |
| Alignment Length: | 261 | Identity: | 70/261 - (26%) |
|---|---|---|---|
| Similarity: | 108/261 - (41%) | Gaps: | 57/261 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 QTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRIFKNEARIVLV 70
Fly 71 KKEKGLW---------PEMFQKLDKEALMQ-------------------KRLEIADLI----VER 103
Fly 104 NKKRDEKALERYDNKRRAEIQKEIQRETDMRERVKQFQENSVREALVVDVRKEAKATPKPDTLQY 168
Fly 169 PPSSGGASRLAT-----------PLMRPPMSSVRGSGRINVNFTTQHKRVTPK--RESQAAMEKA 220
Fly 221 Y 221 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14921 | NP_609491.1 | p23_DYX1C1_like | 4..81 | CDD:107226 | 27/83 (33%) |
| Dnaaf4 | NP_001007011.1 | co-chaperone p23-like domain | 7..103 | 29/90 (32%) | |
| p23_DYX1C1_like | 10..87 | CDD:107226 | 26/74 (35%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 165..212 | 13/55 (24%) | |||
| TPR_11 | 287..351 | CDD:290150 | |||
| TPR repeat | 288..316 | CDD:276809 | |||
| TPR domain | 291..395 | ||||
| TPR_12 | 318..396 | CDD:290160 | |||
| TPR repeat | 321..351 | CDD:276809 | |||
| TPR_1 | 322..351 | CDD:278916 | |||
| TPR repeat | 362..392 | CDD:276809 | |||
| TPR_1 | 365..397 | CDD:278916 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 64 | 1.000 | Inparanoid score | I5272 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_105298 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.860 | |||||