DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14921 and BBS4

DIOPT Version :9

Sequence 1:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster


Alignment Length:206 Identity:43/206 - (20%)
Similarity:74/206 - (35%) Gaps:71/206 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLVTRKPDVVLLPQYLKFNNPPIFFE--------RHLAQEIDEMASFCRIFKNEARIVLV----K 71
            ||:.|:.:..|.|:||.|....|..|        |||.:..:........:|...|.:.:    .
  Fly    54 RLIERELNRHLNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFS 118

  Fly    72 KEKGLWPEMFQK---------------LDKEALMQKRLEIA-----------DLIVERNKKRDEK 110
            :..|::.|..|:               |.:.|..|.:.::|           :|.|:..:|    
  Fly   119 QALGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDVASQQQDEARTYFELAVQSGRK---- 179

  Fly   111 ALERYDNKRRAEI---QKEIQRETDMRE---------------------RVKQFQENSVREALVV 151
             ||.|  .|.||:   .|:.|:..::.|                     ::.:.|:...|.|.||
  Fly   180 -LESY--VRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYLKINETQKAHDRLAEVV 241

  Fly   152 DVRKEAKATPK 162
            .:  |.|.:||
  Fly   242 SI--ERKCSPK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 17/73 (23%)
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 13/63 (21%)
TPR repeat 68..95 CDD:276809 8/26 (31%)
TPR_12 97..175 CDD:290160 10/77 (13%)
TPR repeat 100..130 CDD:276809 4/29 (14%)
TPR repeat 136..175 CDD:276809 5/38 (13%)
TPR repeat 179..209 CDD:276809 10/36 (28%)
TPR_19 190..254 CDD:291240 12/63 (19%)
TPR repeat 214..242 CDD:276809 4/27 (15%)
TPR repeat 249..277 CDD:276809 2/2 (100%)
TPR_11 283..348 CDD:290150
TPR repeat 283..311 CDD:276809
TPR repeat 316..346 CDD:276809
TPR repeat 351..377 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.