DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14921 and IFIT3

DIOPT Version :9

Sequence 1:	NP_609491.1	Gene:	CG14921 / 34547	FlyBaseID:	FBgn0032345	Length:	240	Species:	Drosophila melanogaster
Sequence 2:	NP_001026853.1	Gene:	IFIT3 / 3437	HGNCID:	5411	Length:	490	Species:	Homo sapiens

Alignment Length:	113	Identity:	25/113 - (22%)
Similarity:	50/113 - (44%)	Gaps:	22/113 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    51 IDEMASFCRIFKNEARIVLVKKEKGLWP-----EMFQKLDKEALMQK-RLEIADLIVERNKKRDE 109
            |:.:..:...:.|:|      .||||.|     ::.:.|:.|..... ..|:.|...:::.:| .
Human   307 IEALKQYAMDYSNKA------LEKGLNPLNAYSDLAEFLETECYQTPFNKEVPDAEKQQSHQR-Y 364

  Fly   110 KALERYDNKRR-AEIQKEIQ------RETDMRERVKQFQENSVREALV 150
            ..|::|:.|.. ..:|..::      :.|| :|.:|. |..:|.|.|:
Human   365 CNLQKYNGKSEDTAVQHGLEGLSISKKSTD-KEEIKD-QPQNVSENLL 410

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14921	NP_609491.1	p23_DYX1C1_like	4..81	CDD:107226	8/34 (24%)
IFIT3	NP_001026853.1	TPR_12	51..126	CDD:290160
		TPR 1	51..84
		TPR repeat	51..79	CDD:276809
		TPR repeat	84..123	CDD:276809
		TPR 2	94..127
		TPR 3	136..169
		TPR repeat	136..164	CDD:276809
		TPR_19	150..213	CDD:291240
		TPR 4	172..206
		PRK02603	184..341	CDD:179448	9/39 (23%)
		TPR repeat	206..236	CDD:276809
		TPR 5	207..240
		TPR 6	241..274
		TPR repeat	241..269	CDD:276809
		TPR 7	415..448
		TPR 8	450..481
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	467..490
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900